单选题Based on the configuration shown in the exhibit, what will happen to the traffic matching thesecurity policy?() [edit schedulers] user@host# showscheduler now { monday all-day; tuesday exclude; wednesday { start-time 07:00:00 stop-time 18:00:00; } thursday { start-time 07:00:00 stop-time 18:00:00; } } [edit security policies from-zone Private to-zone External] user@host# showpolicy allowTransit { match { source-address PrivateHosts; destination-address ExtServers; application ExtApps; } then { permit { tunnel { ipsec-vpn myTunnel; } } } scheduler-name now; }AThe traffic is permitted through the myTunnel IPsec tunnel only on Tuesdays.BThe traffic is permitted through the myTunnel IPsec tunnel daily, with the exception of Mondays.CThe traffic is permitted through the myTunnel IPsec tunnel all day on Mondays and Wednesdays between 7:00 am and 6:00 pm, and Thursdays between 7:00 am and 6:00 pm.DThe traffic is permitted through the myTunnel IPsec tunnel all day on Mondays and Wednesdays between 6:01 pm and 6:59 am, and Thursdays between 6:01 pm and 6:59 am
单选题
Based on the configuration shown in the exhibit, what will happen to the traffic matching thesecurity policy?() [edit schedulers] user@host# showscheduler now { monday all-day; tuesday exclude; wednesday { start-time 07:00:00 stop-time 18:00:00; } thursday { start-time 07:00:00 stop-time 18:00:00; } } [edit security policies from-zone Private to-zone External] user@host# showpolicy allowTransit { match { source-address PrivateHosts; destination-address ExtServers; application ExtApps; } then { permit { tunnel { ipsec-vpn myTunnel; } } } scheduler-name now; }
A
The traffic is permitted through the myTunnel IPsec tunnel only on Tuesdays.
B
The traffic is permitted through the myTunnel IPsec tunnel daily, with the exception of Mondays.
C
The traffic is permitted through the myTunnel IPsec tunnel all day on Mondays and Wednesdays between 7:00 am and 6:00 pm, and Thursdays between 7:00 am and 6:00 pm.
D
The traffic is permitted through the myTunnel IPsec tunnel all day on Mondays and Wednesdays between 6:01 pm and 6:59 am, and Thursdays between 6:01 pm and 6:59 am
参考解析
解析:
暂无解析
相关考题:
Basedontheconfigurationshownintheexhibit,whatwillhappentothetrafficmatchingthesecuritypolicy?()[editschedulers]user@hostshowschedulernow{mondayall-day;tuesdayexclude;wednesday{start-time07:00:00stop-time18:00:00;}thursday{start-time07:00:00stop-time18:00:00;}}[editsecuritypoliciesfrom-zonePrivateto-zoneExternal]user@hostshowpolicyallowTransit{match{source-addressPrivateHosts;destination-addressExtServers;applicationExtApps;}then{permit{tunnel{ipsec-vpnmyTunnel;}}}scheduler-namenow;}A.ThetrafficispermittedthroughthemyTunnelIPsectunnelonlyonTuesdays.B.ThetrafficispermittedthroughthemyTunnelIPsectunneldaily,withtheexceptionofMondays.C.ThetrafficispermittedthroughthemyTunnelIPsectunnelalldayonMondaysandWednesdays between7:00amand6:00pm,andThursdaysbetween7:00amand6:00pm.D.ThetrafficispermittedthroughthemyTunnelIPsectunnelalldayonMondaysandWednesdays between6:01pmand6:59am,andThursdaysbetween6:01pmand6:59am
Basedontheconfigurationshownintheexhibit,whataretheactionsofthesecuritypolicy?()[editschedulers]user@hostshowschedulernow{mondayall-day;tuesdayexclude;wednesday{start-time07:00:00stop-time18:00:00;}thursday{start-time07:00:00stop-time18:00:00;}}[editsecuritypoliciesfrom-zonePrivateto-zoneExternal]user@hostshowpolicyallowTransit{match{source-addressPrivateHosts;destination-addressExtServers;applicationExtApps;}then{permit{tunnel{ipsec-vpnmyTunnel;}}}scheduler-namenow;A.ThepolicywillalwayspermittransitpacketsandusetheIPsecVPNmyTunnel.B.ThepolicywillpermittransitpacketsonlyonMonday,andusetheIPsecVPNMytunnel.C.ThepolicywillpermittransitpacketsandusetheIPsecVPNmyTunnelalldayMondayandWednesday 7amto6pm,andThursday7amto6pm.D.Thepolicywillalwayspermittransitpackets,butwillonlyusetheIPsecVPNmyTunnelalldayMonday andWednesday7amto6pm,andThursday7amto6pm.
Based on the configuration shown in the exhibit, what will happen to the traffic matching the securitypolicy?() A. The traffic is permitted through the myTunnel IPSec tunnel only on Tuesdays.B. The traffic is permitted through the myTunnel IPSec tunnel daily, with the exception of Mondays.C. The traffic is permitted through the myTunnel IPSec tunnel all day on Mondays, Wednesdays between 7:00 am and 6:00 pm, and Thursdays between 7:00 am and 6:00 pm.D. The traffic is permitted through the myTunnel IPSec tunnel all day on Mondays, Wednesdays between 6:01 pm and 6:59 am, and Thursdays between 6:01 pm and 6:59 am.
Your network consists of a single Active Directory domain.You have a server named Server1. Server1 has only one hard disk drive.You run a full backup at 02:00 every Monday. You run an incremental backup at 02:00 every Tuesday to Sunday.You run an Automated System Recovery (ASR) backup every day at 13:00.Server1’s hard disk drive fails on Wednesday at 15:00.You need to recover Server1 to its latest configuration by using the minimum amount of administrative effort.What should you restore? ()A. Monday’s full backup, then Tuesday’s incremental backup, and then Wednesday’s incremental backupB. Monday’s full backup and then Wednesday’s ASR backupC. Monday’s full backup and then Wednesday’s incremental backupD. Wednesday’s ASR backup
Based on the configuration shown in the exhibit, what will happen to the traffic matching thesecurity policy?() [edit schedulers] user@host# showscheduler now { monday all-day; tuesday exclude; wednesday { start-time 07:00:00 stop-time 18:00:00; } thursday { start-time 07:00:00 stop-time 18:00:00; } } [edit security policies from-zone Private to-zone External] user@host# showpolicy allowTransit { match { source-address PrivateHosts; destination-address ExtServers; application ExtApps; } then { permit { tunnel { ipsec-vpn myTunnel; } } } scheduler-name now; }A、The traffic is permitted through the myTunnel IPsec tunnel only on Tuesdays.B、The traffic is permitted through the myTunnel IPsec tunnel daily, with the exception of Mondays.C、The traffic is permitted through the myTunnel IPsec tunnel all day on Mondays and Wednesdays between 7:00 am and 6:00 pm, and Thursdays between 7:00 am and 6:00 pm.D、The traffic is permitted through the myTunnel IPsec tunnel all day on Mondays and Wednesdays between 6:01 pm and 6:59 am, and Thursdays between 6:01 pm and 6:59 am
Based on the configuration shown in the exhibit, what are the actions of the security policy?() [edit schedulers] user@host# show scheduler now { monday all-day; tuesday exclude; wednesday { start-time 07:00:00 stop-time 18:00:00; } thursday { start-time 07:00:00 stop-time 18:00:00; } } [edit security policies from-zone Private to-zone External] user@host# showpolicy allowTransit { match { source-address PrivateHosts; destination-address ExtServers; application ExtApps;} then { permit { tunnel { ipsec-vpn myTunnel; } } } scheduler-name now;A、The policy will always permit transit packets and use the IPsec VPN myTunnel.B、The policy will permit transit packets only on Monday, and use the IPsec VPN Mytunnel.C、The policy will permit transit packets and use the IPsec VPN myTunnel all day Monday and Wednesday 7am to 6pm, and Thursday 7am to 6pm.D、The policy will always permit transit packets, but will only use the IPsec VPN myTunnel all day Monday and Wednesday 7am to 6pm, and Thursday 7am to 6pm.
You are the network administrator for All network servers run Windows Server 2003. You perform a full backup of the network every Monday. You perform incremental backups every Tuesday, Wednesday, Thursday, and Friday. Backups are always performed at 1:00 A.M. On Wednesday at noon, one server experiences hard disk failure. You need to restore all data on this server. What should you do?()A、Restore the Wednesday backup, then restore the Tuesday backup, and then restore the Monday backup.B、Restore the Wednesday backup, and then restore the Monday backup.C、Restore the Monday backup, then restore the Tuesday backup, and then restore the Wednesday backup.D、Restore the Monday backups, and then restore the Wednesday backup.
You have a server that runs Windows Server 2003 Service Pack 2 (SP2). You back up the shared folders on the servers by using the following schedule: ·Full backup at 01:00 every Sunday ·Incremental backup at 01:00 every Monday to Friday On a Wednesday afternoon, the hard disk drive that contains the shared folders fails. You need to restore the latest version of all files in the shared folders. The solution must use as few backup tapes as possible. What should you restore? ()A、the files from the full backupB、the files from the full backup and from the Monday, Tuesday, and Wednesday backupsC、the files from the full backup and from the Wednesday backupD、the files from the Wednesday backup
Your network consists of a single Active Directory domain. You have a server named Server1. Server1 has only one hard disk drive. You run a full backup at 02:00 every Monday. You run an incremental backup at 02:00 every Tuesday to Sunday. You run an Automated System Recovery (ASR) backup every day at 13:00. Server1’s hard disk drive fails on Wednesday at 15:00. You need to recover Server1 to its latest configuration by using the minimum amount of administrative effort. What should you restore? ()A、Monday’s full backup, then Tuesday’s incremental backup, and then Wednesday’s incremental backupB、Monday’s full backup and then Wednesday’s ASR backupC、Monday’s full backup and then Wednesday’s incremental backupD、Wednesday’s ASR backup
单选题Based on the configuration shown in the exhibit, what will happen to the traffic matching the security policy?()A The traffic is permitted through the myTunnel IPSec tunnel only on Tuesdays.B The traffic is permitted through the myTunnel IPSec tunnel daily, with the exception of Mondays.C The traffic is permitted through the myTunnel IPSec tunnel all day on Mondays, Wednesdays between 7:00 am and 6:00 pm, and Thursdays between 7:00 am and 6:00 pm.D The traffic is permitted through the myTunnel IPSec tunnel all day on Mondays, Wednesdays between 6:01 pm and 6:59 am, and Thursdays between 6:01 pm and 6:59 am.
单选题You are the network administrator for All network servers run Windows Server 2003. You perform a full backup of the network every Monday. You perform incremental backups every Tuesday, Wednesday, Thursday, and Friday. Backups are always performed at 1:00 A.M. On Wednesday at noon, one server experiences hard disk failure. You need to restore all data on this server. What should you do?()ARestore the Wednesday backup, then restore the Tuesday backup, and then restore the Monday backup.BRestore the Wednesday backup, and then restore the Monday backup.CRestore the Monday backup, then restore the Tuesday backup, and then restore the Wednesday backup.DRestore the Monday backups, and then restore the Wednesday backup.
单选题Given the configuration shown in the exhibit, what will happen to traffic from source 10.10.10.25 destined to 200.200.200.1?()A The traffic will be rejectedB The traffic will be droppedC The traffic will be forwardedD The traffic will be policed
单选题Your network consists of a single Active Directory domain. You have a server named Server1. Server1 has only one hard disk drive. You run a full backup at 02:00 every Monday. You run an incremental backup at 02:00 every Tuesday to Sunday. You run an Automated System Recovery (ASR) backup every day at 13:00. Server1’s hard disk drive fails on Wednesday at 15:00. You need to recover Server1 to its latest configuration by using the minimum amount of administrative effort. What should you restore? ()AMonday’s full backup, then Tuesday’s incremental backup, and then Wednesday’s incremental backupBMonday’s full backup and then Wednesday’s ASR backupCMonday’s full backup and then Wednesday’s incremental backupDWednesday’s ASR backup
单选题Your database has a backup that was taken yesterday (Tuesday) between 13:00 and 15:00 hours. This is the only backup you have. You have lost all the archived redo logs generatedsince the previous Monday, but you have archived redo logs available from the previous Sunday and earlier. You now need to restore your backup due to database loss. To which point can you restore your database?()A 13:00 on Tuesday.B 15:00 on Tuesday.C Up until the last available archived redo log on Sunday.D To any point; all the redo should still be available in the online redo logs.E The database is not recoverable.
单选题You have a server that runs Windows Server 2003 Service Pack 2 (SP2). You back up the shared folders on the servers by using the following schedule: ·Full backup at 01:00 every Sunday ·Incremental backup at 01:00 every Monday to Friday On a Wednesday afternoon, the hard disk drive that contains the shared folders fails. You need to restore the latest version of all files in the shared folders. The solution must use as few backup tapes as possible. What should you restore? ()Athe files from the full backupBthe files from the full backup and from the Monday, Tuesday, and Wednesday backupsCthe files from the full backup and from the Wednesday backupDthe files from the Wednesday backup
单选题Which is the proper time to go to the pub at Cox‘s Hotel?A9:00-18:00 on Friday.B10:30-17:30 on Tuesday.C12:00-1:30 on Saturday.D10:00-16:30 on Monday.
单选题You have a computer that runs Windows XP Professional. Normal backups are scheduled to run every Sunday at 22:00 Eastern Time. Differential backups are scheduled to run every Monday through Saturday at 22:00 Eastern Time. The computer fails on Thursday at 9:00 Eastern Time. You need to restore the computer from the backup by using the most recent data available. You must achieve this goal by using the minimum amount of administrative effort. You reinstall Windows XP Professional on the computer. What should you do next?()ARestore Wednesday’s differential backup. BRestore Sunday’s normal backup. Restore Wednesday’s differential backup. CRestore Sunday’s normal backup. Restore Monday’s differential backup. Restore Tuesday’s differential backup. Restore Wednesday’s differential backup. DRestore Sunday’s normal backup. Restore Wednesday’s differential backup. Restore Tuesday’s differential backup. Restore Monday’s differential backup.
单选题Based on the configuration shown in the exhibit, what are the actions of the security policy?() [edit schedulers] user@host# show scheduler now { monday all-day; tuesday exclude; wednesday { start-time 07:00:00 stop-time 18:00:00; } thursday { start-time 07:00:00 stop-time 18:00:00; } } [edit security policies from-zone Private to-zone External] user@host# showpolicy allowTransit { match { source-address PrivateHosts; destination-address ExtServers; application ExtApps;} then { permit { tunnel { ipsec-vpn myTunnel; } } } scheduler-name now;AThe policy will always permit transit packets and use the IPsec VPN myTunnel.BThe policy will permit transit packets only on Monday, and use the IPsec VPN Mytunnel.CThe policy will permit transit packets and use the IPsec VPN myTunnel all day Monday and Wednesday 7am to 6pm, and Thursday 7am to 6pm.DThe policy will always permit transit packets, but will only use the IPsec VPN myTunnel all day Monday and Wednesday 7am to 6pm, and Thursday 7am to 6pm.
单选题Based on the configuration shown in the exhibit, what are the actions of the security policy?() [edit schedulers] user@host# show scheduler now { monday all-day; tuesday exclude; wednesday { start-time 07:00:00 stop-time 18:00:00; } thursday { start-time 07:00:00 stop-time 18:00:00; } } [edit security policies from-zone Private to-zone External] user@host# showpolicy allowTransit { match { source-address PrivateHosts; destination-address ExtServers; application ExtApps;} then { permit { tunnel { ipsec-vpn myTunnel; } } } scheduler-name now;AThe policy will always permit transit packets and use the IPsec VPN myTunnel.BThe policy will permit transit packets only on Monday, and use the IPsec VPN Mytunnel.CThe policy will permit transit packets and use the IPsec VPN myTunnel all day Monday and Wednesday 7am to 6pm, and Thursday 7am to 6pm.DThe policy will always permit transit packets, but will only use the IPsec VPN myTunnel all day Monday and Wednesday 7am to 6pm, and Thursday 7am to 6pm.
单选题Based on the configuration shown in the exhibit, what will happen to the traffic matching thesecurity policy?() [edit schedulers] user@host# showscheduler now { monday all-day; tuesday exclude; wednesday { start-time 07:00:00 stop-time 18:00:00; } thursday { start-time 07:00:00 stop-time 18:00:00; } } [edit security policies from-zone Private to-zone External] user@host# showpolicy allowTransit { match { source-address PrivateHosts; destination-address ExtServers; application ExtApps; } then { permit { tunnel { ipsec-vpn myTunnel; } } } scheduler-name now; }AThe traffic is permitted through the myTunnel IPsec tunnel only on Tuesdays.BThe traffic is permitted through the myTunnel IPsec tunnel daily, with the exception of Mondays.CThe traffic is permitted through the myTunnel IPsec tunnel all day on Mondays and Wednesdays between 7:00 am and 6:00 pm, and Thursdays between 7:00 am and 6:00 pm.DThe traffic is permitted through the myTunnel IPsec tunnel all day on Mondays and Wednesdays between 6:01 pm and 6:59 am, and Thursdays between 6:01 pm and 6:59 am